Recombinant Full Length Human PDCL Protein, C-Flag-tagged
Cat.No. : | PDCL-1681HFL |
Product Overview : | Recombinant Full Length Human PDCL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Phosducin-like protein is a putative modulator of heterotrimeric G proteins. The protein shares extensive amino acid sequence homology with phosducin, a phosphoprotein expressed in retina and pineal gland. Both phosducin-like protein and phosphoducin have been shown to regulate G-protein signaling by binding to the beta-gamma subunits of G proteins. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.1 kDa |
AA Sequence : | MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPKGVINDWRRFK QLETEQREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQY RKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEAMNGCMICLAAEYP AVKFCKVKSSVIGASSQFTRNALPALLIYKGGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVL VLTSVRNSATCHSEDSDLEIDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | PDCL phosducin like [ Homo sapiens (human) ] |
Official Symbol | PDCL |
Synonyms | PhLP |
Gene ID | 5082 |
mRNA Refseq | NM_005388.5 |
Protein Refseq | NP_005379.3 |
MIM | 604421 |
UniProt ID | Q13371 |
◆ Recombinant Proteins | ||
Pdcl-4737M | Recombinant Mouse Pdcl Protein, Myc/DDK-tagged | +Inquiry |
PDCL-1628H | Recombinant Human PDCL Protein, His (Fc)-Avi-tagged | +Inquiry |
PDCL-3982R | Recombinant Rat PDCL Protein, His (Fc)-Avi-tagged | +Inquiry |
PDCL-3161R | Recombinant Rhesus Macaque PDCL Protein, His (Fc)-Avi-tagged | +Inquiry |
PDCL-3343R | Recombinant Rhesus monkey PDCL Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDCL-3357HCL | Recombinant Human PDCL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDCL Products
Required fields are marked with *
My Review for All PDCL Products
Required fields are marked with *
0
Inquiry Basket