Recombinant Full Length Human PAFAH1B2 Protein, C-Flag-tagged
Cat.No. : | PAFAH1B2-2026HFL |
Product Overview : | Recombinant Full Length Human PAFAH1B2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript variants have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.4 kDa |
AA Sequence : | MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN FGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLL PRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH ELIMQLLEETPEEKQTTIA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Ether lipid metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | PAFAH1B2 platelet activating factor acetylhydrolase 1b catalytic subunit 2 [ Homo sapiens (human) ] |
Official Symbol | PAFAH1B2 |
Synonyms | HEL-S-303 |
Gene ID | 5049 |
mRNA Refseq | NM_002572.4 |
Protein Refseq | NP_002563.1 |
MIM | 602508 |
UniProt ID | P68402 |
◆ Recombinant Proteins | ||
PAFAH1B2-3102R | Recombinant Rhesus Macaque PAFAH1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAFAH1B2-1600H | Recombinant Human PAFAH1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAFAH1B2-12308M | Recombinant Mouse PAFAH1B2 Protein | +Inquiry |
PAFAH1B2-3916R | Recombinant Rat PAFAH1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAFAH1B2-6469M | Recombinant Mouse PAFAH1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAFAH1B2-3468HCL | Recombinant Human PAFAH1B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAFAH1B2 Products
Required fields are marked with *
My Review for All PAFAH1B2 Products
Required fields are marked with *
0
Inquiry Basket