Recombinant Full Length Human P3H1 Protein, C-Flag-tagged
Cat.No. : | P3H1-816HFL |
Product Overview : | Recombinant Full Length Human P3H1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme that is a member of the collagen prolyl hydroxylase family. These enzymes are localized to the endoplasmic reticulum and their activity is required for proper collagen synthesis and assembly. Mutations in this gene are associated with osteogenesis imperfecta type VIII. Three alternatively spliced transcript variants encoding different isoforms have been described. Other variants may exist, but their biological validity has not been determined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 83.2 kDa |
AA Sequence : | MAVRALKLLTTLLAVVAAASQAEVESEAGWGMVTPDLLFAEGTAAYARGDWPGVVLSMERALRSRAALRA LRLRCRTQCAADFPWELDPDWSPSPAQASGAAALRDLSFFGGLLRRAACLRRCLGPPAAHSLSEEMELEF RKRSPYNYLQVAYFKINKLEKAVAAAHTFFVGNPEHMEMQQNLDYYQTMSGVKEADFKDLETQPHMQEFR LGVRLYSEEQPQEAVPHLEAALQEYFVAYEECRALCEGPYDYDGYNYLEYNADLFQAITDHYIQVLNCKQ NCVTELASHPSREKPFEDFLPSHYNYLQFAYYNIGNYTQAVECAKTYLLFFPNDEVMNQNLAYYAAMLGE EHTRSIGPRESAKEYRQRSLLEKELLFFAYDVFGIPFVDPDSWTPEEVIPKRLQEKQKSERETAVRISQE IGNLMKEIETLVEEKTKESLDVSRLTREGGPLLYEGISLTMNSKLLNGSQRVVMDGVISDHECQELQRLT NVAATSGDGYRGQTSPHTPNEKFYGVTVFKALKLGQEGKVPLQSAHLYYNVTEKVRRIIESYFRLDTPLY FSYSHLVCRTAIEEVQAERKDDSHPVHVDNCILNAETLVCVKEPPAYTFRDYSAILYLNGDFDGGNFYFT ELDAKTVTAEVQPQCGRAVGFSSGTENPHGVKAVTRGQRCAIALWFTLDPRHSERDRVQADDLVKMLFSP EEMDLSQEQPLDAQQGPPEPAQESLSGSESKPKDELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | P3H1 prolyl 3-hydroxylase 1 [ Homo sapiens (human) ] |
Official Symbol | P3H1 |
Synonyms | OI8; GROS1; LEPRE1 |
Gene ID | 64175 |
mRNA Refseq | NM_022356.4 |
Protein Refseq | NP_071751.3 |
MIM | 610339 |
UniProt ID | Q32P28 |
◆ Recombinant Proteins | ||
Nppc-719R | Recombinant Rat Nppc protein, His & GST-tagged | +Inquiry |
LY6A-1305M | Recombinant Mouse LY6A protein, His-tagged | +Inquiry |
Shcbp1l-5857M | Recombinant Mouse Shcbp1l Protein, Myc/DDK-tagged | +Inquiry |
CLEC3A-833M | Recombinant Mouse CLEC3A protein, His-tagged | +Inquiry |
IL1RL1-501H | Recombinant Human IL1RL1, FLAG-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin I-12H | Native Human Troponin I protein | +Inquiry |
IgG-332S | Native Swine IgG | +Inquiry |
HBA2-27787TH | Native Human HBA2 | +Inquiry |
KNG1-18H | Native Human Kininogen, LMW | +Inquiry |
CDA002 | Active Native Human MUC16 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETF1-6533HCL | Recombinant Human ETF1 293 Cell Lysate | +Inquiry |
DAOA-7079HCL | Recombinant Human DAOA 293 Cell Lysate | +Inquiry |
HA-004H5N1CL | Recombinant H5N1 HA cell lysate | +Inquiry |
RELB-1493HCL | Recombinant Human RELB cell lysate | +Inquiry |
Small Intestine-452R | Rhesus monkey Small intestine Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All P3H1 Products
Required fields are marked with *
My Review for All P3H1 Products
Required fields are marked with *
0
Inquiry Basket