Recombinant Full Length Human OVGP1 Protein, C-Flag-tagged
Cat.No. : | OVGP1-1014HFL |
Product Overview : | Recombinant Full Length Human OVGP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. The gene is similar to members of the mucin and the glycosyl hydrolase 18 gene families. Regulation of expression may be estrogen-dependent. Gene expression and protein secretion occur during late follicular development through early cleavage-stage embryonic development. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 75.2 kDa |
AA Sequence : | MWKLLLWVGLVLVLKHHDGAAHKLVCYFTNWAHSRPGPASILPHDLDPFLCTHLIFAFASMNNNQIVAKD LQDEKILYPEFNKLKERNRELKTLLSIGGWNFGTSRFTTMLSTFANREKFIASVISLLRTHDFDGLDLFF LYPGLRGSPMHDRWTFLFLIEELLFAFRKEALLTMRPRLLLSAAVSGVPHIVQTSYDVRFLGRLLDFINV LSYDLHGSWERFTGHNSPLFSLPEDPKSSAYAMNYWRKLGAPSEKLIMGIPTYGRTFRLLKASKNGLQAR AIGPASPGKYTKQEGFLAYFEICSFVWGAKKHWIDYQYVPYANKGKEWVGYDNAISFSYKAWFIRREHFG GAMVWTLDMDDVRGTFCGTGPFPLVYVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPERLAVTTAWTTD SKILPPGGEAGVTEIHGKCENMTITPRGTTVTPTKETVSLGKHTVALGEKTEITGAMTMTSVGHQSMTPG EKALTPVGHQSVTTGQKTLTSVGYQSVTPGEKTLTPVGHQSVTPVSHQSVSPGGTTMTPVHFQTETLRQN TVAPRRKAVAREKVTVPSRNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQL PEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | OVGP1 oviductal glycoprotein 1 [ Homo sapiens (human) ] |
Official Symbol | OVGP1 |
Synonyms | EGP; OGP; MUC9; CHIT5 |
Gene ID | 5016 |
mRNA Refseq | NM_002557.4 |
Protein Refseq | NP_002548.3 |
MIM | 603578 |
UniProt ID | Q12889 |
◆ Recombinant Proteins | ||
OVGP1-3081R | Recombinant Rhesus Macaque OVGP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ovgp1-8010M | Recombinant Mouse Ovgp1 protein, His & T7-tagged | +Inquiry |
OVGP1-1483H | Recombinant Human OVGP1, GST-tagged | +Inquiry |
Ovgp1-888M | Recombinant Mouse Ovgp1 Protein, MYC/DDK-tagged | +Inquiry |
OVGP1-2536H | Recombinant Human OVGP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OVGP1-3509HCL | Recombinant Human OVGP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OVGP1 Products
Required fields are marked with *
My Review for All OVGP1 Products
Required fields are marked with *
0
Inquiry Basket