Recombinant Full Length Human Outer Dense Fiber Protein 4(Odf4) Protein, His-Tagged
Cat.No. : | RFL10943HF |
Product Overview : | Recombinant Full Length Human Outer dense fiber protein 4(ODF4) Protein (Q2M2E3) (1-257aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-257) |
Form : | Lyophilized powder |
AA Sequence : | MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLSLSSNRSLGQ RQNSPLPFQWRITHSFRWMAQVLASELSLVAFILLLVVAFSKKWLDLSRSLFYQRWPVDV SNRIHTSAHVMSMGLLHFYKSRSCSDLENGKVTFIFSTLMLFPINIWIFELERNVSIPIG WSYFIGWLVLILYFTCAILCYFNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDT PITQEGVLDPEQKDTHV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ODF4 |
Synonyms | ODF4; OPPO1; Outer dense fiber protein 4; Outer dense fiber of sperm tails protein 4; Testis-specific protein oppo 1; hOPPO1 |
UniProt ID | Q2M2E3 |
◆ Recombinant Proteins | ||
RFL33571RF | Recombinant Full Length Rat Outer Dense Fiber Protein 4(Odf4) Protein, His-Tagged | +Inquiry |
ODF4-4158R | Recombinant Rat ODF4 Protein | +Inquiry |
Odf4-4577M | Recombinant Mouse Odf4 Protein, Myc/DDK-tagged | +Inquiry |
ODF4-6320M | Recombinant Mouse ODF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL19898BF | Recombinant Full Length Bovine Outer Dense Fiber Protein 4(Odf4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ODF4-3594HCL | Recombinant Human ODF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ODF4 Products
Required fields are marked with *
My Review for All ODF4 Products
Required fields are marked with *
0
Inquiry Basket