Recombinant Full Length Human Olfactory Receptor 6K3(Or6K3) Protein, His-Tagged
Cat.No. : | RFL17002HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 6K3(OR6K3) Protein (Q8NGY3) (1-331aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-331) |
Form : | Lyophilized powder |
AA Sequence : | MCWTMPSPFTGSSTRNMESGNQSTVTEFIFTGFPQLQDGSLLYFFPLLFIYTFIIIDNLL IFSAVRLDTHLHNPMYNFISIFSFLEIWYTTATIPKMLSNLISEKKAISMTGCILQMYFF HSLENSEGILLTTMAIDRYVAICNPLRYQMIMTPRLCAQLSAGSCLFGFLILLPEIVMIS TLPFCGPNQIHQIFCDLVPVLSLACTDTSMILIEDVIHAVTIIITFLIIALSYVRIVTVI LRIPSSEGRQKAFSTCAGHLMVFPIFFGSVSLMYLRFSDTYPPVLDTAIALMFTVLAPFF NPIIYSLRNKDMNNAIKKLFCLQKVLNKPGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR6K3 |
Synonyms | OR6K3; Olfactory receptor 6K3; Olfactory receptor OR1-18 |
UniProt ID | Q8NGY3 |
◆ Recombinant Proteins | ||
CCDC88B-10822H | Recombinant Human CCDC88B, GST-tagged | +Inquiry |
CNTN6-687H | Recombinant Human CNTN6 Protein (Met1-Ser999), HIgG1 Fc-tagged | +Inquiry |
RFL36005RF | Recombinant Full Length Rat Trace Amine-Associated Receptor 7A(Taar7A) Protein, His-Tagged | +Inquiry |
ITK-5438H | Recombinant Human IL2-Inducible T-Cell Kinase, GST-tagged | +Inquiry |
MIA2-950H | Recombinant Human MIA2 protein | +Inquiry |
◆ Native Proteins | ||
VTN -51P | Native Porcine multimeric vitronectin | +Inquiry |
TRIM21-212B | Native Cow TRIM21 | +Inquiry |
ALB-584P | Native Guinea Pig ALB protein | +Inquiry |
ALPA-1184P | Native Porcine Alkaline Phosphatase Activity | +Inquiry |
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2330HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
P815-172H | P815 Whole Cell Lysate | +Inquiry |
GFAP-5955HCL | Recombinant Human GFAP 293 Cell Lysate | +Inquiry |
EIF2S1-542HCL | Recombinant Human EIF2S1 cell lysate | +Inquiry |
Epididymus-21H | Human Epididymus Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR6K3 Products
Required fields are marked with *
My Review for All OR6K3 Products
Required fields are marked with *
0
Inquiry Basket