Recombinant Full Length Human Olfactory Receptor 6J1(Or6J1) Protein, His-Tagged
Cat.No. : | RFL6841HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 6J1(OR6J1) Protein (Q8NGC5) (1-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-347) |
Form : | Lyophilized powder |
AA Sequence : | MGNWTAAVTEFVLLGFSLSREVELLLLVLLLPTFLLTLLGNLLIISTVLSCSRLHTPMYF FLCNLSILDILFTSVISPKVLANLGSRDKTISFAGCITQCYFYFFLGTVEFLLLTVMSYD RYATICCPLRYTTIMRPSVCIGTVVFSWVGGFLSVLFPTILISQLPFCGSNIINHFFCDS GPLLALACADTTAIELMDFMLSSMVILCCIVLVAYSYTYIILTIVRIPSASGRKKAFNTC ASHLTIVIIPSGITVFIYVTPSQKEYLEINKIPLVLSSVVTPFLNPFIYTLRNDTVQGVL RDVWVRVRGVFEKRMRAVLRSRLSSNKDHQGRACSSPPCVYSVKLQC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR6J1 |
Synonyms | OR6J1; OR6J2; Olfactory receptor 6J1; Olfactory receptor 6J2 |
UniProt ID | Q8NGC5 |
◆ Recombinant Proteins | ||
SAP093A-002-1960S | Recombinant Staphylococcus aureus (strain: SK1529, other: Tc) SAP093A_002 protein, His-tagged | +Inquiry |
RAB2A-836C | Recombinant Cynomolgus RAB2A Protein, His-tagged | +Inquiry |
CTSE-26489TH | Recombinant Human CTSE | +Inquiry |
RFL9093SF | Recombinant Full Length Sulfurimonas Denitrificans Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
CLK4-2206HF | Recombinant Full Length Human CLK4 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
HP-75C | Native Canine Haptoglobin | +Inquiry |
TF-47C | Native Cattle Transferrin (TRF) Protein | +Inquiry |
SERPINA1-8009H | Native Human Serum Alpha 1 AntiTrypsin | +Inquiry |
LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
Lectin-1766D | Active Native Datura Stramonium Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR2G-3032HCL | Recombinant Human POLR2G 293 Cell Lysate | +Inquiry |
Testis-663G | Guinea Pig Testis Lysate, Total Protein | +Inquiry |
EZH2-6487HCL | Recombinant Human EZH2 293 Cell Lysate | +Inquiry |
ZNF200-126HCL | Recombinant Human ZNF200 293 Cell Lysate | +Inquiry |
TMEM30B-959HCL | Recombinant Human TMEM30B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR6J1 Products
Required fields are marked with *
My Review for All OR6J1 Products
Required fields are marked with *
0
Inquiry Basket