Recombinant Full Length Human Olfactory Receptor 4K3(Or4K3) Protein, His-Tagged
Cat.No. : | RFL18489HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 4K3(OR4K3) Protein (Q96R72) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MAWSNQSAVTEFILRGLSSSLELQIFYFLFFSIVYAATVLGNLLIVVTIASEPHLHSPMY FLLGNLSFIDMSLASFATPKMIADFLREHKAISFEGCMTQMFFLHLLGGAEIVLLISMSF DRYVAICKPLHYLTIMSRRMCVGLVILSWIVGIFHALSQLAFTVNLPFCGPNEVDSFFCD LPLVIKLACVDTYILGVFMISTSGMIALVCFILLVISYTIILVTVRQRSSGGSSKALSTC SAHFTVVTLFFGPCTFIYVWPFTNFPIDKVLSVFYTIYTPLLNPVIYTVRNKDVKYSMRK LSSHIFKSRKTDHTP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR4K3 |
Synonyms | OR4K3; OR4K3P; Olfactory receptor 4K3; Olfactory receptor OR14-14 |
UniProt ID | Q96R72 |
◆ Recombinant Proteins | ||
COL7A1-30HL | Recombinant Human COL7A1 Cell Lysate, Myc/DDK-tagged | +Inquiry |
PDGFB-6595M | Recombinant Mouse PDGFB Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF10D-8826C | Recombinant Cynomolgus TNFRSF10D, His tagged | +Inquiry |
GYG1-2765R | Recombinant Rat GYG1 Protein | +Inquiry |
MOCS2-9949M | Recombinant Mouse MOCS2 Protein | +Inquiry |
◆ Native Proteins | ||
Col4-20M | Native Mouse Collagen IV protein | +Inquiry |
CT-34 | Native Chlamydia trachomatis Antigen | +Inquiry |
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
FGG -60R | Native Rabbit Fibrinogen | +Inquiry |
Prothrombin-293M | Native Mouse Prothrombin Frag-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEX9-1138HCL | Recombinant Human TEX9 293 Cell Lysate | +Inquiry |
Amygdala-16R | Rhesus monkey Amygdala Lysate | +Inquiry |
CISD2-7489HCL | Recombinant Human CISD2 293 Cell Lysate | +Inquiry |
DUS3L-514HCL | Recombinant Human DUS3L cell lysate | +Inquiry |
PHKG2-3222HCL | Recombinant Human PHKG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR4K3 Products
Required fields are marked with *
My Review for All OR4K3 Products
Required fields are marked with *
0
Inquiry Basket