Recombinant Full Length Human Olfactory Receptor 10W1(Or10W1) Protein, His-Tagged
Cat.No. : | RFL16345HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 10W1(OR10W1) Protein (Q8NGF6) (1-305aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-305) |
Form : | Lyophilized powder |
AA Sequence : | MEFVFLAYPSCPELHILSFLGVSLVYGLIITGNILIVVSIHTETCLCTSMYYFLGSLSGI EICYTAVVVPHILANTLQSEKTITLLGCATQMAFFIALGSADCFLLAAMAYDRYVAICHP LQYPLLMTLTLCVHLVVASVISGLFLSLQLVAFIFSLPFCQAQGIEHFFCDVPPVMHVVC AQSHIHEQSVLVAAILAIAVPFFLITTSYTFIVAALLKIHSAAGRHRAFSTCSSHLTVVL LQYGCCAFMYLCPSSSYNPKQDRFISLVYTLGTPLLNPLIYALRNSEMKGAVGRVLTRNC LSQNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR10W1 |
Synonyms | OR10W1; OR10W1P; UNQ6469/PRO34070; Olfactory receptor 10W1; Olfactory receptor OR11-236 |
UniProt ID | Q8NGF6 |
◆ Recombinant Proteins | ||
KRT8-4941M | Recombinant Mouse KRT8 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALX4-2459H | Recombinant Human ALX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GCM1-3509M | Recombinant Mouse GCM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BRE-335H | Recombinant Human BRE Protein, GST-tagged | +Inquiry |
ANTXR1-160H | Recombinant Human ANTXR1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-356B | Native Bovine Gamma Globulin Fraction | +Inquiry |
CG-76H | Active Native Human Chorionic Gonadotropin (CG) | +Inquiry |
Troponin-01H | Native Human Troponin Protein | +Inquiry |
Pepsin-27H | Native Human Pepsin (PP) Protein | +Inquiry |
Collagen Type IV-08H | Native Human Collagen Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
Eye-92M | Mouse Eye Tissue Lysate (14 Days Old) | +Inquiry |
MITF-4306HCL | Recombinant Human MITF 293 Cell Lysate | +Inquiry |
CCDC41-7765HCL | Recombinant Human CCDC41 293 Cell Lysate | +Inquiry |
HOXB5-5422HCL | Recombinant Human HOXB5 293 Cell Lysate | +Inquiry |
ADAM32-9034HCL | Recombinant Human ADAM32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR10W1 Products
Required fields are marked with *
My Review for All OR10W1 Products
Required fields are marked with *
0
Inquiry Basket