Recombinant Full Length Human NUTF2 Protein, C-Flag-tagged
Cat.No. : | NUTF2-2047HFL |
Product Overview : | Recombinant Full Length Human NUTF2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cytosolic factor that facilitates protein transport into the nucleus. The encoded protein is required for nuclear import of the small Ras-like GTPase, Ran which is involved in numerous cellular processes. This protein also interacts with the nuclear pore complex glycoprotein p62. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 14.3 kDa |
AA Sequence : | MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITA QDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NUTF2 nuclear transport factor 2 [ Homo sapiens (human) ] |
Official Symbol | NUTF2 |
Synonyms | NTF2; PP15; NTF-2 |
Gene ID | 10204 |
mRNA Refseq | NM_005796.3 |
Protein Refseq | NP_005787.1 |
MIM | 605813 |
UniProt ID | P61970 |
◆ Recombinant Proteins | ||
NUTF2-3795R | Recombinant Rat NUTF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUTF2-3298H | Recombinant Human NUTF2 protein, GST-tagged | +Inquiry |
NUTF2-2542H | Recombinant Human Nuclear Transport Factor 2 | +Inquiry |
NUTF2-1566H | Recombinant Human NUTF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUTF2-1425H | Recombinant Human NUTF2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUTF2-448HCL | Recombinant Human NUTF2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUTF2 Products
Required fields are marked with *
My Review for All NUTF2 Products
Required fields are marked with *
0
Inquiry Basket