Recombinant Full Length Human NUDT11 Protein, C-Flag-tagged

• Cat.No.: NUDT11-2097HFL
• Product Overview: Recombinant Full Length Human NUDT11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: NUDT11 belongs to a subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 18.4 kDa
• AA Sequence: MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA GVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL EKLKLGGSPTNGNSMAPSSPDSDP myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: NUDT11 nudix hydrolase 11 [ Homo sapiens (human) ]
• Official Symbol: NUDT11
• Synonyms: APS1; ASP1; DIPP3b; DIPP3beta; hDIPP3beta
• Gene ID: 55190
• mRNA Refseq: NM_018159.4
• Protein Refseq: NP_060629.2
• MIM: 300528
• UniProt ID: Q96G61