Recombinant Full Length Human NR1D2 Protein, GST-tagged

• Cat.No.: NR1D2-6693HF
• Product Overview: Human NR1D2 full-length ORF ( AAH45613, 1 a.a. - 579 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 89.21 kDa
• Protein length: 579 amino acids
• AA Sequence: MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NR1D2 nuclear receptor subfamily 1, group D, member 2 [ Homo sapiens ]
• Official Symbol: NR1D2
• Synonyms: NR1D2; nuclear receptor subfamily 1, group D, member 2; nuclear receptor subfamily 1 group D member 2; BD73; EAR 1r; Hs.37288; HZF2; RVR; rev-erb-beta; rev-erba-alpha-related receptor; V-erbA-related protein 1-related; orphan nuclear hormone receptor BD73; nuclear receptor Rev-ErbA beta variant 1; nuclear receptor Rev-ErbA beta variant 2; EAR-1R
• Gene ID: 9975
• mRNA Refseq: NM_001145425
• Protein Refseq: NP_001138897
• MIM: 602304
• UniProt ID: Q14995