Recombinant Full Length Human NPY Protein, GST-tagged

• Cat.No.: NPY-6654HF
• Product Overview: Human NPY full-length ORF ( AAH29497, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 36.41 kDa
• Protein length: 97 amino acids
• AA Sequence: MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPY neuropeptide Y [ Homo sapiens ]
• Official Symbol: NPY
• Synonyms: NPY; neuropeptide Y; pro-neuropeptide Y; PYY4
• Gene ID: 4852
• mRNA Refseq: NM_000905
• Protein Refseq: NP_000896
• MIM: 162640
• UniProt ID: P01303