Recombinant Full Length Human NPR3 Protein, C-Flag-tagged
Cat.No. : | NPR3-104HFL |
Product Overview : | Recombinant Full Length Human NPR3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of three natriuretic peptide receptors. Natriutetic peptides are small peptides which regulate blood volume and pressure, pulmonary hypertension, and cardiac function as well as some metabolic and growth processes. The product of this gene encodes a natriuretic peptide receptor responsible for clearing circulating and extracellular natriuretic peptides through endocytosis of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 59.6 kDa |
AA Sequence : | MPSLLVLTFSPCVLLGWALLAGGTGGGGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLPQDDSYLFSLT RVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA APVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLE RNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMT SGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNM EDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIA MTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSCGLEESAVTGIVVGA LLGAGLLMAFYFFRKKYRITIERRTQQEESNLGKHRELREDSIRSHFSVATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | NPR3 natriuretic peptide receptor 3 [ Homo sapiens (human) ] |
Official Symbol | NPR3 |
Synonyms | NPRC; ANP-C; ANPRC; BOMOS; NPR-C; ANPR-C; GUCY2B; C5orf23 |
Gene ID | 4883 |
mRNA Refseq | NM_000908.4 |
Protein Refseq | NP_000899.1 |
MIM | 108962 |
UniProt ID | P17342 |
◆ Recombinant Proteins | ||
NPR3-1532H | Recombinant Human NPR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPR3-5487H | Recombinant Human NPR3 protein, His-Myc-tagged | +Inquiry |
NPR3-12H | Active Recombinant Human NPR3 Protein (Thr24-Glu481), C-Fc tagged | +Inquiry |
Npr3-8252R | Recombinant Rat Npr3 protein, His & T7-tagged | +Inquiry |
NPR3-3288H | Recombinant Human NPR3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPR3-3732HCL | Recombinant Human NPR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPR3 Products
Required fields are marked with *
My Review for All NPR3 Products
Required fields are marked with *
0
Inquiry Basket