Recombinant Full Length Human NPR1 Protein, C-Flag-tagged
Cat.No. : | NPR1-357HFL |
Product Overview : | Recombinant Full Length Human NPR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms. The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surface receptors with a similar topographic structure: an extracellular ligand-binding domain, a single membrane-spanning domain, and an intracellular region that contains a protein kinase-like domain and a cyclase catalytic domain. GC-A and GC-B function as receptors for natriuretic peptides; they are also referred to as atrial natriuretic peptide receptor A (NPR1) and type B. Also see NPR3, which encodes a protein with only the ligand-binding transmembrane and 37-amino acid cytoplasmic domains. NPR1 is a membrane-bound guanylate cyclase that serves as the receptor for both atrial and brain natriuretic peptides and BNP, respectively. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 118.7 kDa |
AA Sequence : | MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVELALAQVKARP DLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVYAAAPVGRFTAHWRVPLLTAG APALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDR LNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSL QGGQGPAPRRPWERGDGQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDVLVNTIP ASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGSLSLLGILIVS FFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTAYYK GNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESIT LDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKL WTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQ SHLEELGLLMQRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDA VIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPV CAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYW LLGERGSSTRGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Purine metabolism, Vascular smooth muscle contraction |
Full Length : | Full L. |
Gene Name | NPR1 natriuretic peptide receptor 1 [ Homo sapiens (human) ] |
Official Symbol | NPR1 |
Synonyms | ANPa; NPRA; ANPRA; GUC2A; GUCY2A |
Gene ID | 4881 |
mRNA Refseq | NM_000906.4 |
Protein Refseq | NP_000897.3 |
MIM | 108960 |
UniProt ID | P16066 |
◆ Native Proteins | ||
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
TTR-141S | Native Sheep prealbumin | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
CDA002 | Active Native Human MUC16 Protein | +Inquiry |
AMY1A-5313H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLEKHG2-1375HCL | Recombinant Human PLEKHG2 cell lysate | +Inquiry |
CNP-7397HCL | Recombinant Human CNP 293 Cell Lysate | +Inquiry |
NA-536HCL | Recombinant H1N1 NA cell lysate | +Inquiry |
ID3-5310HCL | Recombinant Human ID3 293 Cell Lysate | +Inquiry |
ASCC1-8656HCL | Recombinant Human ASCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NPR1 Products
Required fields are marked with *
My Review for All NPR1 Products
Required fields are marked with *
0
Inquiry Basket