Recombinant Full Length Human NPM3 Protein, GST-tagged

• Cat.No.: NPM3-6640HF
• Product Overview: Human NPM3 full-length ORF ( NP_008924.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 178 amino acids
• Description: The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. [provided by RefSeq
• Molecular Mass: 45.7 kDa
• AA Sequence: MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPM3 nucleophosmin/nucleoplasmin 3 [ Homo sapiens ]
• Official Symbol: NPM3
• Synonyms: NPM3; nucleophosmin/nucleoplasmin 3; nucleoplasmin-3; nucleophosmin/nucleoplasmin family, member 3; PORMIN; TMEM123
• Gene ID: 10360
• mRNA Refseq: NM_006993
• Protein Refseq: NP_008924
• MIM: 606456
• UniProt ID: O75607