Recombinant Full Length Human NPM2 Protein, GST-tagged

• Cat.No.: NPM2-6638HF
• Product Overview: Human NPM2 full-length ORF ( NP_877724.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 214 amino acids
• Description: NPM2 (Nucleophosmin/Nucleoplasmin 2) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and enzyme binding. An important paralog of this gene is NPM1.
• Molecular Mass: 50.6 kDa
• AA Sequence: MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPM2 nucleophosmin/nucleoplasmin 2 [ Homo sapiens ]
• Official Symbol: NPM2
• Synonyms: NPM2; nucleophosmin/nucleoplasmin 2; nucleoplasmin-2; MGC78655
• Gene ID: 10361
• mRNA Refseq: NM_182795
• Protein Refseq: NP_877724
• MIM: 608073
• UniProt ID: Q86SE8