Recombinant Full Length Human NPM1 Protein
Cat.No. : | NPM1-346HF |
Product Overview : | Recombinant full length Human Nucleophosmin with N terminal proprietary tag, 58.45kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 295 amino acids |
Description : | This gene encodes a phosphoprotein which moves between the nucleus and the cytoplasm. The gene product is thought to be involved in several processes including regulation of the ARF/p53 pathway. A number of genes are fusion partners have been characterized, in particular the anaplastic lymphoma kinase gene on chromosome 2. Mutations in this gene are associated with acute myeloid leukemia. More than a dozen pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants. |
Form : | Liquid |
Molecular Mass : | 58.450kDa inclusive of tags |
AA Sequence : | MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEH QLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK MSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAA DEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTP AKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTD QEAIQDLWQWRKSL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ] |
Official Symbol | NPM1 |
Synonyms | NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin; B23; NPM; nucleolar phosphoprotein B23; nucleophosmin/nucleoplasmin family; member 1; numatrin |
Gene ID | 4869 |
mRNA Refseq | NM_001037738 |
Protein Refseq | NP_001032827 |
MIM | 164040 |
UniProt ID | P06748 |
◆ Recombinant Proteins | ||
NPM1-7985HFL | Recombinant Full Length Human NPM1 protein, Flag-tagged | +Inquiry |
NPM1-135H | Recombinant Human NPM1 protein, MYC/DDK-tagged | +Inquiry |
Npm1-4474M | Recombinant Mouse Npm1 Protein, Myc/DDK-tagged | +Inquiry |
NPM1-231H | Recombinant Human NPM1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
NPM1-7530H | Recombinant Human NPM1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPM1-3739HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
NPM1-3738HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPM1 Products
Required fields are marked with *
My Review for All NPM1 Products
Required fields are marked with *
0
Inquiry Basket