Recombinant Full Length Human NPFF Protein, GST-tagged

• Cat.No.: NPFF-6617HF
• Product Overview: Human NPFF full-length ORF ( AAI04235.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 116 amino acids
• Description: FMFRamide-related protein precursor plays a role in the regulation of heart rate and blood pressure and the modulation of morphine-induced antinociception. FMRFAL encodes a preproprotein which is cleaved to form two active peptides with similar function. [provided by RefSeq
• Molecular Mass: 39.4 kDa
• AA Sequence: MVPQPPTTCPWKPVPSPCDLRVQGICPSSFPDTPLAQEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPFF neuropeptide FF-amide peptide precursor [ Homo sapiens ]
• Official Symbol: NPFF
• Synonyms: NPFF; neuropeptide FF-amide peptide precursor; FMRFamide-related peptides; FMRFAL
• Gene ID: 8620
• mRNA Refseq: NM_003717
• Protein Refseq: NP_003708
• MIM: 604643
• UniProt ID: O15130