Recombinant Full Length Human NDUFA13 Protein, GST-tagged

Description :	This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined. [provided by RefSeq, Oct 2009]
Source :	In Vitro Cell Free System
Species :	Human
Tag :	GST
Molecular Mass :	41.58 kDa
Protein length :	144 amino acids
AA Sequence :	MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	NDUFA13 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 [ Homo sapiens ]
Official Symbol	NDUFA13
Synonyms	NDUFA13; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; B16.6; CDA016; CGI 39; complex I B16.6 subunit; GRIM 19; GRIM19; CI-B16.6; complex I-B16.6; cell death-regulatory protein GRIM19; cell death regulatory protein GRIM-19; NADH-ubiquinone oxidoreductase B16.6 subunit; gene associated with retinoic and IFN-induced mortality 19 protein; gene associated with retinoic and interferon-induced mortality 19 protein; CGI-39; GRIM-19; FLJ58045; FLJ59191;
Gene ID	51079
mRNA Refseq	NM_015965
Protein Refseq	NP_057049
MIM	609435
UniProt ID	Q9P0J0