Recombinant Full Length Human NDUFA13 Protein, GST-tagged
Cat.No. : | NDUFA13-5663HF |
Product Overview : | Human GRIM19 full-length ORF ( AAH09189, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 144 amino acids |
Description : | This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 41.58 kDa |
AA Sequence : | MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NDUFA13 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 [ Homo sapiens ] |
Official Symbol | NDUFA13 |
Synonyms | NDUFA13; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; B16.6; CDA016; CGI 39; complex I B16.6 subunit; GRIM 19; GRIM19; CI-B16.6; complex I-B16.6; cell death-regulatory protein GRIM19; cell death regulatory protein GRIM-19; NADH-ubiquinone oxidoreductase B16.6 subunit; gene associated with retinoic and IFN-induced mortality 19 protein; gene associated with retinoic and interferon-induced mortality 19 protein; CGI-39; GRIM-19; FLJ58045; FLJ59191; |
Gene ID | 51079 |
mRNA Refseq | NM_015965 |
Protein Refseq | NP_057049 |
MIM | 609435 |
UniProt ID | Q9P0J0 |
◆ Cell & Tissue Lysates | ||
NDUFA13-3922HCL | Recombinant Human NDUFA13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NDUFA13 Products
Required fields are marked with *
My Review for All NDUFA13 Products
Required fields are marked with *
0
Inquiry Basket