Recombinant Full Length Human MZT2B Protein, GST-tagged

• Cat.No.: MZT2B-4567HF
• Product Overview: Human FAM128B full-length ORF ( NP_079305.2, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 158 amino acids
• Description: MZT2B (Mitotic Spindle Organizing Protein 2B) is a Protein Coding gene. An important paralog of this gene is MZT2A.
• Molecular Mass: 42.6 kDa
• AA Sequence: MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MZT2B mitotic spindle organizing protein 2B [ Homo sapiens (human) ]
• Official Symbol: MZT2B
• Synonyms: MZT2B; mitotic spindle organizing protein 2B; Mitotic Spindle Organizing Protein 2B; Mitotic-Spindle Organizing Protein Associated With A Ring Of Gamma-Tubulin 2B; Family With Sequence Similarity 128, Member B; MOZART2B; FAM128B; Mitotic-Spindle Organizing Protein 2B; mitotic-spindle organizing protein 2B; family with sequence similarity 128, member B; mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2B
• Gene ID: 80097
• mRNA Refseq: NM_001330282
• Protein Refseq: NP_001317211
• MIM: 613450
• UniProt ID: Q6NZ67