Recombinant Full Length Human MZT2B Protein, GST-tagged

Cat.No. : MZT2B-4567HF
Product Overview : Human FAM128B full-length ORF ( NP_079305.2, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 158 amino acids
Description : MZT2B (Mitotic Spindle Organizing Protein 2B) is a Protein Coding gene. An important paralog of this gene is MZT2A.
Molecular Mass : 42.6 kDa
AA Sequence : MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MZT2B mitotic spindle organizing protein 2B [ Homo sapiens (human) ]
Official Symbol MZT2B
Synonyms MZT2B; mitotic spindle organizing protein 2B; Mitotic Spindle Organizing Protein 2B; Mitotic-Spindle Organizing Protein Associated With A Ring Of Gamma-Tubulin 2B; Family With Sequence Similarity 128, Member B; MOZART2B; FAM128B; Mitotic-Spindle Organizing Protein 2B; mitotic-spindle organizing protein 2B; family with sequence similarity 128, member B; mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2B
Gene ID 80097
mRNA Refseq NM_001330282
Protein Refseq NP_001317211
MIM 613450
UniProt ID Q6NZ67

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MZT2B Products

Required fields are marked with *

My Review for All MZT2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon