Recombinant Full Length Human MYL7 Protein, GST-tagged

Cat.No. : MYL7-6764HF
Product Overview : Human MYL7 full-length ORF (BAG34810.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 175 amino acids
Description : MYL7 (Myosin Light Chain 7) is a Protein Coding gene. Diseases associated with MYL7 include Fechtner Syndrome and Familial Atrial Fibrillation. Among its related pathways are Focal Adhesion and Sertoli-Sertoli Cell Junction Dynamics. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is MYL5.
Molecular Mass : 45.65 kDa
AA Sequence : MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYL7 myosin light chain 7 [ Homo sapiens (human) ]
Official Symbol MYL7
Synonyms MYL7; myosin, light chain 7, regulatory; myosin, light polypeptide 7, regulatory; myosin regulatory light chain 2, atrial isoform; MYL2A; MYLC2A; MLC2a; MLC-2a; myosin light chain 2a; myosin regulatory light chain 7;
Gene ID 58498
mRNA Refseq NM_021223
Protein Refseq NP_067046
MIM 613993
UniProt ID Q01449

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MYL7 Products

Required fields are marked with *

My Review for All MYL7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon