Recombinant Full Length Human MTF2 Protein, GST-tagged

• Cat.No.: MTF2-6498HF
• Product Overview: Human MTF2 full-length ORF ( AAH10013.1, 1 a.a. - 536 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 536 amino acids
• Description: MTF2 (Metal Response Element Binding Transcription Factor 2) is a Protein Coding gene. Among its related pathways are Mesodermal Commitment Pathway and Interactome of polycomb repressive complex 2 (PRC2). GO annotations related to this gene include methylated histone binding. An important paralog of this gene is PHF19.
• Molecular Mass: 84.7 kDa
• AA Sequence: MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMEVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTF2 metal response element binding transcription factor 2 [ Homo sapiens ]
• Official Symbol: MTF2
• Synonyms: MTF2; metal response element binding transcription factor 2; metal-response element-binding transcription factor 2; M96; PCL2; polycomb like 2; hPCl2; polycomb-like 2; polycomb-like protein 2; putative DNA binding protein; metal regulatory transcription factor 2; metal-response element DNA-binding protein M96; metal response element-binding transcription factor 2; dJ976O13.2; RP5-976O13.1
• Gene ID: 22823
• mRNA Refseq: NM_001164391
• Protein Refseq: NP_001157863
• MIM: 609882
• UniProt ID: Q9Y483