Recombinant Full Length Human MSN Protein, C-Flag-tagged
Cat.No. : | MSN-317HFL |
Product Overview : | Recombinant Full Length Human MSN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.6 kDa |
AA Sequence : | MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDV RKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKE VHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKN KKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMER LKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALE MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEA SADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLR QIRQGNTKQRIDEFESMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Leukocyte transendothelial migration, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | MSN moesin [ Homo sapiens (human) ] |
Official Symbol | MSN |
Synonyms | HEL70; IMD50 |
Gene ID | 4478 |
mRNA Refseq | NM_002444.3 |
Protein Refseq | NP_002435.1 |
MIM | 309845 |
UniProt ID | P26038 |
◆ Recombinant Proteins | ||
RNF187-4738R | Recombinant Rat RNF187 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTDSS1-13629M | Recombinant Mouse PTDSS1 Protein | +Inquiry |
RFL2757ZF | Recombinant Full Length Zea Mays Oleosin Zm-Ii(Ole18) Protein, His-Tagged | +Inquiry |
RFL1588MF | Recombinant Full Length Mouse Glucose-Dependent Insulinotropic Receptor(Gpr119) Protein, His-Tagged | +Inquiry |
CASQ2-0436H | Recombinant Human CASQ2 Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1715U | Native Ulex europaeus Lectin, FITC conjugated | +Inquiry |
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
CTSB-1647H | Native Human Cathepsin B | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HeLa-14H | HeLa Cell Nuclear Extract - Etoposide Stimulated | +Inquiry |
ETV7-6518HCL | Recombinant Human ETV7 293 Cell Lysate | +Inquiry |
PELO-3302HCL | Recombinant Human PELO 293 Cell Lysate | +Inquiry |
CCDC40-296HCL | Recombinant Human CCDC40 cell lysate | +Inquiry |
Postcentral Gyrus-397H | Human Postcentral Gyrus (Alzheimers Disease) Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSN Products
Required fields are marked with *
My Review for All MSN Products
Required fields are marked with *
0
Inquiry Basket