Recombinant Full Length Human MS4A7 Protein, GST-tagged

• Cat.No.: MS4A7-6551HF
• Product Overview: Human MS4A7 full-length ORF ( AAH20673, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 52.14 kDa
• Protein length: 240 amino acids
• AA Sequence: MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MS4A7 membrane-spanning 4-domains, subfamily A, member 7 [ Homo sapiens ]
• Official Symbol: MS4A7
• Synonyms: MS4A7; membrane-spanning 4-domains, subfamily A, member 7; membrane-spanning 4-domains subfamily A member 7; CD20L4; CFFM4; MS4A8; CD20 antigen-like 4; four-span transmembrane protein 2; CD20/Fc-epsilon-RI-beta family member 4; high affinity immunoglobulin epsilon receptor beta subunit; 4SPAN2; MGC22368
• Gene ID: 58475
• mRNA Refseq: NM_021201
• Protein Refseq: NP_067024
• MIM: 606502
• UniProt ID: Q9GZW8