Recombinant Full Length Human MS4A15 Protein, GST-tagged

• Cat.No.: MS4A15-6403HF
• Product Overview: Human MGC35295 full-length ORF ( AAH31610.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 147 amino acids
• Description: MS4A15 (Membrane Spanning 4-Domains A15) is a Protein Coding gene. An important paralog of this gene is MS4A12.
• Molecular Mass: 41.91 kDa
• AA Sequence: MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNVAYAQGVV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MS4A15 membrane-spanning 4-domains, subfamily A, member 15 [ Homo sapiens ]
• Official Symbol: MS4A15
• Synonyms: MS4A15; membrane-spanning 4-domains, subfamily A, member 15; membrane-spanning 4-domains subfamily A member 15; FLJ34527; MGC35295
• Gene ID: 219995
• mRNA Refseq: NM_001098835
• Protein Refseq: NP_001092305
• UniProt ID: Q8N5U1