Recombinant Full Length Human MRPS30 Protein, C-Flag-tagged
Cat.No. : | MRPS30-1671HFL |
Product Overview : | Recombinant Full Length Human MRPS30 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that is similar to the chicken pro-apoptotic protein p52. Transcript variants using alternative promoters or polyA sites have been mentioned in the literature but the complete description of these sequences is not available. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.2 kDa |
AA Sequence : | MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATV HAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLA ALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYW VRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYEN HIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEAD VTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQ IVHFLLNRPKEEKSQLLENTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MRPS30 mitochondrial ribosomal protein S30 [ Homo sapiens (human) ] |
Official Symbol | MRPS30 |
Synonyms | PAP; PDCD9; S30mt; MRP-S30 |
Gene ID | 10884 |
mRNA Refseq | NM_016640.4 |
Protein Refseq | NP_057724.2 |
MIM | 611991 |
UniProt ID | Q9NP92 |
◆ Recombinant Proteins | ||
MRPS30-6500HF | Recombinant Full Length Human MRPS30 Protein, GST-tagged | +Inquiry |
MRPS30-6499C | Recombinant Chicken MRPS30 | +Inquiry |
MRPS30-1671HFL | Recombinant Full Length Human MRPS30 Protein, C-Flag-tagged | +Inquiry |
MRPS30-1935H | Recombinant Human MRPS30 Protein, MYC/DDK-tagged | +Inquiry |
MRPS30-5523Z | Recombinant Zebrafish MRPS30 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS30-1135HCL | Recombinant Human MRPS30 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPS30 Products
Required fields are marked with *
My Review for All MRPS30 Products
Required fields are marked with *
0
Inquiry Basket