Recombinant Full Length Human MRPL52 Protein, C-Flag-tagged

• Cat.No.: MRPL52-1797HFL
• Product Overview: Recombinant Full Length Human MRPL52 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which has no bacterial homolog. Multiple transcript variants encoding different protein isoforms were identified through sequence analysis.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 13.5 kDa
• AA Sequence: MAALGTVLFTGVRRLHCSAAAWAGGQWRLQQGLAANPSGYGPLTELPDCSYADGRPAPPMKGQLRRKAER ETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: MRPL52 mitochondrial ribosomal protein L52 [ Homo sapiens (human) ]
• Official Symbol: MRPL52
• Synonyms: mitochondrial ribosomal protein L52; OTTHUMP00000164489
• Gene ID: 122704
• mRNA Refseq: NM_178336.3
• Protein Refseq: NP_848026.1
• MIM: 611856
• UniProt ID: Q86TS9