Recombinant Full Length Human MREG Protein, GST-tagged

• Cat.No.: MREG-4697HF
• Product Overview: Human DSU full-length ORF ( AAH32747, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 214 amino acids
• Description: MREG (Melanoregulin) is a Protein Coding gene.
• Molecular Mass: 49.28 kDa
• AA Sequence: MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MREG melanoregulin [ Homo sapiens ]
• Official Symbol: MREG
• Synonyms: MREG; melanoregulin; DSU; FLJ10116; WDT2; whn-dependent transcript 2; dilute suppressor protein homolog; MGC90296
• Gene ID: 55686
• mRNA Refseq: NM_018000
• Protein Refseq: NP_060470
• MIM: 609207
• UniProt ID: Q8N565