Recombinant Full Length Human MPZL1 Protein, GST-tagged

• Cat.No.: MPZL1-6338HF
• Product Overview: Human MPZL1 full-length ORF ( AAH07881, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 269 amino acids
• Description: MPZL1 (Myelin Protein Zero Like 1) is a Protein Coding gene. Diseases associated with MPZL1 include Noonan Syndrome 1. Among its related pathways are Cell adhesion molecules (CAMs) and Tyrosine Kinases / Adaptors. GO annotations related to this gene include structural molecule activity. An important paralog of this gene is MPZ.
• Molecular Mass: 55.33 kDa
• AA Sequence: MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MPZL1 myelin protein zero-like 1 [ Homo sapiens ]
• Official Symbol: MPZL1
• Synonyms: MPZL1; myelin protein zero-like 1; myelin protein zero-like protein 1; FLJ21047; PZR; protein zero related; protein zero-related; immunoglobulin family transmembrane protein; PZRa; PZRb; PZR1b; MPZL1b
• Gene ID: 9019
• mRNA Refseq: NM_001146191
• Protein Refseq: NP_001139663
• MIM: 604376
• UniProt ID: O95297