Recombinant Full Length Human MOBP Protein, GST-tagged

• Cat.No.: MOBP-6297HF
• Product Overview: Human MOBP full-length ORF ( AAH22471, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 81 amino acids
• Description: MOBP (Myelin-Associated Oligodendrocyte Basic Protein) is a Protein Coding gene. Diseases associated with MOBP include Substance Abuse and Corticobasal Degeneration. GO annotations related to this gene include Rab GTPase binding and structural constituent of myelin sheath. An important paralog of this gene is MYRIP.
• Molecular Mass: 34.65 kDa
• AA Sequence: MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRLKRKIRPTPKKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOBP myelin-associated oligodendrocyte basic protein [ Homo sapiens ]
• Official Symbol: MOBP
• Synonyms: MOBP; myelin-associated oligodendrocyte basic protein; MGC87379
• Gene ID: 4336
• mRNA Refseq: NM_182935
• Protein Refseq: NP_891980
• MIM: 600948
• UniProt ID: Q13875