Recombinant Full Length Human MMP7 Protein, GST-tagged

Cat.No. : MMP7-6280HF
Product Overview : Human MMP7 full-length ORF ( NP_002414.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 267 amino acids
Description : Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq
Molecular Mass : 56.1 kDa
AA Sequence : MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MMP7 matrix metallopeptidase 7 (matrilysin, uterine) [ Homo sapiens ]
Official Symbol MMP7
Synonyms MMP7; matrix metallopeptidase 7 (matrilysin, uterine); matrix metalloproteinase 7 (matrilysin, uterine) , MPSL1; matrilysin; PUMP 1; matrin; pump-1 protease; uterine matrilysin; uterine metalloproteinase; matrix metalloproteinase-7; matrix metalloproteinase 7 (matrilysin, uterine); MMP-7; MPSL1; PUMP-1;
Gene ID 4316
mRNA Refseq NM_002423
Protein Refseq NP_002414
MIM 178990
UniProt ID P09237

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MMP7 Products

Required fields are marked with *

My Review for All MMP7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon