Recombinant Full Length Human MMP14 Protein, C-Flag-tagged
Cat.No. : | MMP14-1787HFL |
Product Overview : | Recombinant Full Length Human MMP14 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 protein, and this activity may be involved in tumor invasion. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.8 kDa |
AA Sequence : | MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQK FYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYAT YEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIG GDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQ QLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVM DGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQK LKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVF FFRRHGTPRRLLYCQRSLLDKV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease, Transmembrane |
Protein Pathways : | GnRH signaling pathway |
Full Length : | Full L. |
Gene Name | MMP14 matrix metallopeptidase 14 [ Homo sapiens (human) ] |
Official Symbol | MMP14 |
Synonyms | MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; WNCHRS; MT1-MMP; MT-MMP 1 |
Gene ID | 4323 |
mRNA Refseq | NM_004995.4 |
Protein Refseq | NP_004986.1 |
MIM | 600754 |
UniProt ID | P50281 |
◆ Recombinant Proteins | ||
Mmp14-4098M | Recombinant Mouse Mmp14 Protein, Myc/DDK-tagged | +Inquiry |
MMP14-33H | Active Recombinant Human MMP14 protein, mutation C127S | +Inquiry |
MMP14-39H | Active Recombinant Human MMP14, His-tagged | +Inquiry |
RFL2938MF | Recombinant Full Length Mouse Matrix Metalloproteinase-14(Mmp14) Protein, His-Tagged | +Inquiry |
MMP14-808H | Active Recombinant Human MMP14 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP14-4279HCL | Recombinant Human MMP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP14 Products
Required fields are marked with *
My Review for All MMP14 Products
Required fields are marked with *
0
Inquiry Basket