Recombinant Full Length Human Mitochondrial Dicarboxylate Carrier(Slc25A10) Protein, His-Tagged
Cat.No. : | RFL36069HF |
Product Overview : | Recombinant Full Length Human Mitochondrial dicarboxylate carrier(SLC25A10) Protein (Q9UBX3) (1-287aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-287) |
Form : | Lyophilized powder |
AA Sequence : | MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILAL YSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPA DLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLS CYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHC AVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC25A10 |
Synonyms | SLC25A10; DIC; Mitochondrial dicarboxylate carrier; Solute carrier family 25 member 10 |
UniProt ID | Q9UBX3 |
◆ Recombinant Proteins | ||
SLC25A10-2715H | Recombinant Human SLC25A10, His-tagged | +Inquiry |
SLC25A10-4240R | Recombinant Rhesus monkey SLC25A10 Protein, His-tagged | +Inquiry |
SLC25A10-4056R | Recombinant Rhesus Macaque SLC25A10 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A10-2065H | Recombinant Human SLC25A10 Protein, His&GST-tagged | +Inquiry |
SLC25A10-11389Z | Recombinant Zebrafish SLC25A10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A10-1785HCL | Recombinant Human SLC25A10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC25A10 Products
Required fields are marked with *
My Review for All SLC25A10 Products
Required fields are marked with *
0
Inquiry Basket