Recombinant Full Length Human MIER3 Protein, GST-tagged

• Cat.No.: MIER3-4696HF
• Product Overview: Human DKFZP781I1119 full-length ORF ( AAH41348.2, 1 a.a. - 522 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 522 amino acids
• Description: MIER3 (MIER Family Member 3) is a Protein Coding gene. GO annotations related to this gene include chromatin binding. An important paralog of this gene is MIER1.
• Molecular Mass: 84.9 kDa
• AA Sequence: MLVHDYDDERTLEEEEMMDEGKNFSSEIEDLEKEGTMPLEDLLAFYGYEPTIPAVANSSANSSPSELADELPDMTLDKEEIAKDLLSGDDEETQSSADGLTPSVTSHETSDFFPRPLRSNTACDGDKESEVEDVETDSGNSPEDLRKEIMIGLQYQAEIPPYLGEYDGNEKVYENEDQLLWCPDVVLESKVKEYLVETSLRTGSEKIMDRISAGTHTRDNEQALYELLKCNHNIKEAIERYCCNGKASQGMTAWTEEECRSFEHALMLFGKDFHLIQKNKVRTRTVAECVAFYYMWKKSERYDYFAQQTRFGKKRYNHHPGVTDYMDRLVDETEALGGTVNASALTSNRPEPIPDQQLNILNSFTASDLTALTNSVATVCDPTDVNCLDDSFPPLGNTPRGQVNHVPVVTEELLTLPSNGESDCFNLFETGFYHSELNPMNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFISAHALHQHAALHSE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MIER3 mesoderm induction early response 1, family member 3 [ Homo sapiens ]
• Official Symbol: MIER3
• Synonyms: MIER3; mesoderm induction early response 1, family member 3; mesoderm induction early response protein 3; DKFZp686L09111; DKFZp781I1119; FLJ35954; mi-er3; DKFZp781G1119
• Gene ID: 166968
• mRNA Refseq: NM_152622
• Protein Refseq: NP_689835
• UniProt ID: Q7Z3K6