Recombinant Full Length Human METTL7A Protein, GST-tagged

• Cat.No.: METTL7A-6177HF
• Product Overview: Human METTL7A full-length ORF ( NP_054752.3, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 244 amino acids
• Description: METTL7A (Methyltransferase Like 7A) is a Protein Coding gene. Among its related pathways are Innate Immune System. GO annotations related to this gene include methyltransferase activity and S-adenosylmethionine-dependent methyltransferase activity. An important paralog of this gene is METTL7B.
• Molecular Mass: 54.7 kDa
• AA Sequence: MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METTL7A methyltransferase like 7A [ Homo sapiens ]
• Official Symbol: METTL7A
• Synonyms: METTL7A; methyltransferase like 7A; methyltransferase-like protein 7A; DKFZP586A0522; protein AAM-B; AAM-B; DKFZp586A0522
• Gene ID: 25840
• mRNA Refseq: NM_014033
• Protein Refseq: NP_054752
• MIM: 618338
• UniProt ID: Q9H8H3