Recombinant Full Length Human METTL4 Protein, C-Flag-tagged
Cat.No. : | METTL4-977HFL |
Product Overview : | Recombinant Full Length Human METTL4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables RNA methyltransferase activity and site-specific DNA-methyltransferase (adenine-specific) activity. Involved in nucleic acid metabolic process; regulation of RNA metabolic process; and regulation of mitochondrial DNA replication. Located in cytosol; mitochondrial matrix; and nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.9 kDa |
AA Sequence : | MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTK PENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVF NQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPS LNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKT FDVIVIDPPWQNKSVKRSNRYSYLSPLQIKQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEV VAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHK PPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIALESGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | METTL4 methyltransferase 4, N6-adenosine [ Homo sapiens (human) ] |
Official Symbol | METTL4 |
Synonyms | HsT661 |
Gene ID | 64863 |
mRNA Refseq | NM_022840.5 |
Protein Refseq | NP_073751.3 |
MIM | 619626 |
UniProt ID | Q8N3J2 |
◆ Recombinant Proteins | ||
RGS7BP-3695R | Recombinant Rhesus Macaque RGS7BP Protein, His (Fc)-Avi-tagged | +Inquiry |
UCK2B-10153Z | Recombinant Zebrafish UCK2B | +Inquiry |
HA1-1125I | Recombinant H9N2 (A/spot-billed duck/Jiangxi/33 /2011) HA1 Protein, His-tagged | +Inquiry |
ADRB2-30C | Recombinant Cynomolgus Monkey ADRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SEPT4-8026M | Recombinant Mouse SEPT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
Troponin T-12H | Native Human cardiac Troponin T protein | +Inquiry |
Clostripain-01C | Native Clostridium histolyticum Clostripain | +Inquiry |
ELANE-8104H | Native Human Neutrophil Elastase | +Inquiry |
Chitin-001C | Native Crawfish Chitin | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKAP12-8941HCL | Recombinant Human AKAP12 293 Cell Lysate | +Inquiry |
SNF8-1629HCL | Recombinant Human SNF8 293 Cell Lysate | +Inquiry |
IGFBP7-1694HCL | Recombinant Human IGFBP7 cell lysate | +Inquiry |
MAP3K5-4504HCL | Recombinant Human MAP3K5 293 Cell Lysate | +Inquiry |
YKT6-243HCL | Recombinant Human YKT6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All METTL4 Products
Required fields are marked with *
My Review for All METTL4 Products
Required fields are marked with *
0
Inquiry Basket