Recombinant Full Length Human METTL22 Protein, GST-tagged

• Cat.No.: METTL22-6169HF
• Product Overview: Human METTL22 full-length ORF ( AAH01908.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 205 amino acids
• Description: This gene encodes a member of the non-histone lysine methyltransferases. It interacts with its substrate, Kin17, which is involved in DNA repair and replication and mRNA processing. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
• Molecular Mass: 48.2 kDa
• AA Sequence: MVQLAPAAAMDEVTFRSDTVLSDVHLYTPNHRHLMVRLNSVGQPVFLSQFKLLWSQDSWTDSGAKGGSHRDVHTKEPPSAETGSTGSPPGSGHGNEGFSLQAGTDTTGQEVAEAQLDEDGDLDVVRRPRAASDSNPAGPLRDKVHPMILAQEEDDVLGEEAQGSPHDIIRIGVAGRPAPGRLHPVPTGPLPRMYSAGARGRHGAR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METTL22 methyltransferase like 22 [ Homo sapiens ]
• Official Symbol: METTL22
• Synonyms: C16orf68; METTL22; methyltransferase like 22
• Gene ID: 79091
• mRNA Refseq: NM_024109
• Protein Refseq: NP_077014
• MIM: 615261
• UniProt ID: Q9BUU2