Recombinant Full Length Human METTL16 Protein, C-Flag-tagged
Cat.No. : | METTL16-1104HFL |
Product Overview : | Recombinant Full Length Human METTL16 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables RNA binding activity and RNA methyltransferase activity. Involved in RNA modification and regulation of mRNA metabolic process. Located in cytoplasm and nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63.4 kDa |
AA Sequence : | MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEAVRALTCTLLREDFGLSIDI PLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFN YAKKNVEQNNLSDLIKVVKVPQKTLLMDALKEESEIIYDFCMCNPPFFANQLEAKGVNSRNPRRPPPSSV NTGGITEIMAEGGELEFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKEELRIQGVPKVTYTEFCQGRT MRWALAWSFYDDVTVPSPPSKRRKLEKPRKPITFVVLASVMKELSLKASPLRSETAEGIVVVTTWIEKIL TDLKVQHKRVPCGKEEVSLFLTAIENSWIHLRRKKRERVRQLREVPRAPEDVIQALEEKKPTPKESGNSQ ELARGPQERTPCGPALREGEAAAVEGPCPSQESLSQEENPEPTEDERSEEKGGVEVLENCQGSSNGAQDQ EASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMHWVEGQNRDLMNQLCTYIRNQIFRLVA VNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | METTL16 methyltransferase 16, N6-methyladenosine [ Homo sapiens (human) ] |
Official Symbol | METTL16 |
Synonyms | METT10D |
Gene ID | 79066 |
mRNA Refseq | NM_024086.4 |
Protein Refseq | NP_076991.3 |
UniProt ID | Q86W50 |
◆ Recombinant Proteins | ||
METTL16-4409H | Recombinant Human METTL16 Protein, GST-tagged | +Inquiry |
METTL16-13HFL | Recombinant Full Length Human METTL16 Protein, N-Flag-tagged | +Inquiry |
METTL16-2609H | Recombinant Human METTL16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
METTL16-042H | Recombinant Human METTL16 Protein, GST-tagged | +Inquiry |
METTL16-433C | Recombinant Cynomolgus Monkey METTL16 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL16-4361HCL | Recombinant Human METT10D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All METTL16 Products
Required fields are marked with *
My Review for All METTL16 Products
Required fields are marked with *
0
Inquiry Basket