Recombinant Full Length Human Metallophosphoesterase 1(Mppe1) Protein, His-Tagged
Cat.No. : | RFL12658HF |
Product Overview : | Recombinant Full Length Human Metallophosphoesterase 1(MPPE1) Protein (Q53F39) (1-396aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-396) |
Form : | Lyophilized powder |
AA Sequence : | MAMIELGFGRQNFHPLKRKSSLLLKLIAVVFAVLLFCEFLIYYLAIFQCNWPEVKTTASD GEQTTREPVLKAMFLADTHLLGEFLGHWLDKLRREWQMERAFQTALWLLQPEVVFILGDI FDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAGNHDIGFHYEMNTYKVERFEKVFSS ERLFSWKGINFVMVNSVALNGDGCGICSETEAELIEVSHRLNCSREARGSSRCGPGPLLP TSAPVLLQHYPLYRRSDANCSGEDAAPAEERDIPFKENYDVLSREASQKLLWWLQPRLVL SGHTHSACEVHHGGRVPELSVPSFSWRNRNNPSFIMGSITPTDYTLSKCYLPREDVVLII YCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPPE1 |
Synonyms | MPPE1; PGAP5; PP579; Metallophosphoesterase 1; Post-GPI attachment to proteins factor 5 |
UniProt ID | Q53F39 |
◆ Recombinant Proteins | ||
C5AR1-2655HF | Recombinant Full Length Human C5AR1 Protein, GST-tagged | +Inquiry |
ANGPT2-325R | Recombinant Rat ANGPT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Envelope-301V | Recombinant SARS Coronavirus Envelope protein | +Inquiry |
ATL1-274R | Recombinant Rhesus Macaque ATL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRO-301378H | Recombinant Human TRO protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
ACTA1-853R | Native Rabbit ACTA1 Protein | +Inquiry |
CAT-5276H | Native Human, Catalase | +Inquiry |
CA 72-4-379H | Active Native Human Cancer Antigen 72-4 | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDCD10-3363HCL | Recombinant Human PDCD10 293 Cell Lysate | +Inquiry |
SIT1-1827HCL | Recombinant Human SIT1 293 Cell Lysate | +Inquiry |
HBZ-5615HCL | Recombinant Human HBZ 293 Cell Lysate | +Inquiry |
EIF3C-543HCL | Recombinant Human EIF3C cell lysate | +Inquiry |
SSU72-1451HCL | Recombinant Human SSU72 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MPPE1 Products
Required fields are marked with *
My Review for All MPPE1 Products
Required fields are marked with *
0
Inquiry Basket