Recombinant Full Length Human Membrane Progestin Receptor Beta(Paqr8) Protein, His-Tagged
Cat.No. : | RFL21894HF |
Product Overview : | Recombinant Full Length Human Membrane progestin receptor beta(PAQR8) Protein (Q8TEZ7) (1-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-354) |
Form : | Lyophilized powder |
AA Sequence : | MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGH EWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSI TYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFL PAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGC QEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAI LLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PAQR8 |
Synonyms | PAQR8; C6orf33; LMPB1; MPRB; Membrane progestin receptor beta; mPR beta; Lysosomal membrane protein in brain 1; Membrane progesterone P4 receptor beta; Membrane progesterone receptor beta; Progesterone and adipoQ receptor family member 8; Progestin and ad |
UniProt ID | Q8TEZ7 |
◆ Recombinant Proteins | ||
PAQR8-3302R | Recombinant Rhesus monkey PAQR8 Protein, His-tagged | +Inquiry |
PAQR8-856H | Recombinant Human PAQR8 | +Inquiry |
RFL6247SF | Recombinant Full Length Pig Membrane Progestin Receptor Beta(Paqr8) Protein, His-Tagged | +Inquiry |
PAQR8-1840C | Recombinant Chicken PAQR8 | +Inquiry |
PAQR8-12354M | Recombinant Mouse PAQR8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAQR8-3437HCL | Recombinant Human PAQR8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAQR8 Products
Required fields are marked with *
My Review for All PAQR8 Products
Required fields are marked with *
0
Inquiry Basket