Recombinant Full Length Human MELTF Protein, C-Flag-tagged
Cat.No. : | MELTF-1936HFL |
Product Overview : | Recombinant Full Length Human MELTF Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a cell-surface glycoprotein found on melanoma cells. The protein shares sequence similarity and iron-binding properties with members of the transferrin superfamily. The importance of the iron binding function has not yet been identified. This gene resides in the same region of chromosome 3 as members of the transferrin superfamily. Alternative splicing results in two transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 78.2 kDa |
AA Sequence : | MRGPSGALWLLLALRTVLGGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQ EADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVTIDTLKGVKSCHTGINRTVGW NVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDY SGAFRCLAEGAGDVAFVKHSTVLENTDGKTLPSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHA VVVRADTDGGLIFRLLNEGQRLFSHEGSSFQMFSSEAYGQKDLLFKDSTSELVPIATQTYEAWLGHEYLH AMKGLLCDPNRLPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTL SGEDIYTAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGFGSPAGWDVPV GALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAF RCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVR PDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAA LEGMSSQQCSGAAAPAPGAPLLPLLLPALAARLLPPAL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | MELTF melanotransferrin [ Homo sapiens (human) ] |
Official Symbol | MELTF |
Synonyms | MTf; MFI2; MTF1; CD228; MAP97 |
Gene ID | 4241 |
mRNA Refseq | NM_005929.6 |
Protein Refseq | NP_005920.2 |
MIM | 155750 |
UniProt ID | P08582 |
◆ Recombinant Proteins | ||
MPRIP-3398R | Recombinant Rat MPRIP Protein, His (Fc)-Avi-tagged | +Inquiry |
IL6-314H | Active Recombinant Human IL6, MIgG2a Fc-tagged, mutant | +Inquiry |
COX17-984R | Recombinant Rhesus monkey COX17 Protein, His-tagged | +Inquiry |
RFL29188MF | Recombinant Full Length Methanococcus Maripaludis Cobalt Transport Protein Cbin(Cbin) Protein, His-Tagged | +Inquiry |
LMAN2L-8612H | Recombinant Human LMAN2L, Fc tagged | +Inquiry |
◆ Native Proteins | ||
FGA-34D | Native Canine Fibrinogen | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
MMP9-41H | Native Human MMP-9/TIMP-1 Complex | +Inquiry |
BPI-72H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
A1AGP-01P | Native Porcine A1AGP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDN1-6721HCL | Recombinant Human EDN1 293 Cell Lysate | +Inquiry |
FAM50A-6371HCL | Recombinant Human FAM50A 293 Cell Lysate | +Inquiry |
SNX32-1590HCL | Recombinant Human SNX32 293 Cell Lysate | +Inquiry |
TSPAN4-708HCL | Recombinant Human TSPAN4 293 Cell Lysate | +Inquiry |
Duodenum-114H | Human Duodenum Tumor Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MELTF Products
Required fields are marked with *
My Review for All MELTF Products
Required fields are marked with *
0
Inquiry Basket