Recombinant Full Length Human MEA1 Protein, C-Flag-tagged
Cat.No. : | MEA1-1998HFL |
Product Overview : | Recombinant Full Length Human MEA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be involved in male gonad development. Predicted to be located in cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 19.7 kDa |
AA Sequence : | MGPERHLSGAPARMATVVLGGDTMGPERIFPNQTEELGHQGPSEGTGDWSSEEPEEEQEETGSGPAGYSY QPLNQDPEQEEVELAPVGDGDVVADIQDRIQALGLHLPDPPLESEDEDEEGATALNNHSSIPMDPEHVEL VKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQASPAWK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MEA1 male-enhanced antigen 1 [ Homo sapiens (human) ] |
Official Symbol | MEA1 |
Synonyms | HYS; MEA |
Gene ID | 4201 |
mRNA Refseq | NM_014623.4 |
Protein Refseq | NP_055438.1 |
MIM | 143170 |
UniProt ID | Q16626 |
◆ Recombinant Proteins | ||
MEA1-681C | Recombinant Cynomolgus MEA1 Protein, His-tagged | +Inquiry |
MEA1-9674M | Recombinant Mouse MEA1 Protein | +Inquiry |
MEA1-3288R | Recombinant Rat MEA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEA1-2712R | Recombinant Rhesus monkey MEA1 Protein, His-tagged | +Inquiry |
MEA1-3632R | Recombinant Rat MEA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEA1-4398HCL | Recombinant Human MEA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEA1 Products
Required fields are marked with *
My Review for All MEA1 Products
Required fields are marked with *
0
Inquiry Basket