Recombinant Full Length Human MCTS1 Protein, GST-tagged

• Cat.No.: MCTS1-6097HF
• Product Overview: Human MCTS1 full-length ORF ( AAH01013, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 181 amino acids
• Description: MCTS1 (MCTS1, Re-Initiation And Release Factor) is a Protein Coding gene. GO annotations related to this gene include RNA binding and translation initiation factor activity.
• Molecular Mass: 45.65 kDa
• AA Sequence: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MCTS1 malignant T cell amplified sequence 1 [ Homo sapiens ]
• Official Symbol: MCTS1
• Synonyms: MCTS1; malignant T cell amplified sequence 1; malignant T-cell-amplified sequence 1; MCT 1; multiple copies T-cell malignancies; malignant T cell-amplified sequence 1; MCT1; MCT-1; FLJ39637
• Gene ID: 28985
• mRNA Refseq: NM_001137554
• Protein Refseq: NP_001131026
• MIM: 300587
• UniProt ID: Q9ULC4