Recombinant Full Length Human MCTS1 Protein, GST-tagged
Cat.No. : | MCTS1-6097HF |
Product Overview : | Human MCTS1 full-length ORF ( AAH01013, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 181 amino acids |
Description : | MCTS1 (MCTS1, Re-Initiation And Release Factor) is a Protein Coding gene. GO annotations related to this gene include RNA binding and translation initiation factor activity. |
Molecular Mass : | 45.65 kDa |
AA Sequence : | MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MCTS1 malignant T cell amplified sequence 1 [ Homo sapiens ] |
Official Symbol | MCTS1 |
Synonyms | MCTS1; malignant T cell amplified sequence 1; malignant T-cell-amplified sequence 1; MCT 1; multiple copies T-cell malignancies; malignant T cell-amplified sequence 1; MCT1; MCT-1; FLJ39637; |
Gene ID | 28985 |
mRNA Refseq | NM_001137554 |
Protein Refseq | NP_001131026 |
MIM | 300587 |
UniProt ID | Q9ULC4 |
◆ Recombinant Proteins | ||
Mcts1-4000M | Recombinant Mouse Mcts1 Protein, Myc/DDK-tagged | +Inquiry |
MCTS1-280H | Recombinant Human MCTS1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MCTS1-4506H | Recombinant Human MCTS1 Protein, GST-tagged | +Inquiry |
MCTS1-4951H | Recombinant Human MCTS1 protein, His-SUMO-tagged | +Inquiry |
MCTS1-3755C | Recombinant Chicken MCTS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCTS1-4410HCL | Recombinant Human MCTS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MCTS1 Products
Required fields are marked with *
My Review for All MCTS1 Products
Required fields are marked with *
0
Inquiry Basket