Recombinant Full Length Human MAT2A Protein, C-Flag-tagged
Cat.No. : | MAT2A-837HFL |
Product Overview : | Recombinant Full Length Human MAT2A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene catalyzes the production of S-adenosylmethionine (AdoMet) from methionine and ATP. AdoMet is the key methyl donor in cellular processes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43.5 kDa |
AA Sequence : | MNGQLNGFHEAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGE ITSRAAVDYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGVHLDRNEEDIGAGDQGLMFG YATDETEECMPLTIVLAHKLNAKLAELRRNGTLPWLRPDSKTQVTVQYMQDRGAVLPIRVHTIVISVQHD EEVCLDEMRDALKEKVIKAVVPAKYLDEDTIYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGG AFSGKDYTKVDRSAAYAARWVAKSLVKGGLCRRVLVQVSYAIGVSHPLSISIFHYGTSQKSERELLEIVK KNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLKYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Cysteine and methionine metabolism, Metabolic pathways, Selenoamino acid metabolism |
Full Length : | Full L. |
Gene Name | MAT2A methionine adenosyltransferase 2A [ Homo sapiens (human) ] |
Official Symbol | MAT2A |
Synonyms | MATA2; MATII; SAMS2 |
Gene ID | 4144 |
mRNA Refseq | NM_005911.6 |
Protein Refseq | NP_005902.1 |
MIM | 601468 |
UniProt ID | P31153 |
◆ Recombinant Proteins | ||
MAT2A-3251R | Recombinant Rat MAT2A Protein, His (Fc)-Avi-tagged | +Inquiry |
MAT2A-5384M | Recombinant Mouse MAT2A Protein, His (Fc)-Avi-tagged | +Inquiry |
MAT2A-28860TH | Recombinant Human MAT2A, T7 -tagged | +Inquiry |
MAT2A-4500H | Recombinant Human MAT2A Protein (Leu176-Tyr395), His tagged | +Inquiry |
MAT2A-1517H | Recombinant Human MAT2A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAT2A-4454HCL | Recombinant Human MAT2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAT2A Products
Required fields are marked with *
My Review for All MAT2A Products
Required fields are marked with *
0
Inquiry Basket