Recombinant Full Length Human MAP2K1 Protein, C-Flag-tagged
Cat.No. : | MAP2K1-234HFL |
Product Overview : | Recombinant Full Length Human MAP2K1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43.3 kDa |
AA Sequence : | MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEK ISELGAGNGGVVFKVSHKSSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEIS ICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFG VSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVE GDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERA DLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Acute myeloid leukemia, B cell receptor signaling pathway, Bladder cancer, Chemokine signaling pathway, Chronic myeloid leukemia, Colorectal cancer, Dorso-ventral axis formation, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Gap junction, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term depression, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Melanoma, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Non-small cell lung cancer, Oocyte meiosis, Pancreatic cancer, Pathways in cancer, Prion diseases, Progesterone-mediated oocyte maturation, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Thyroid cancer, Toll-like receptor signaling pathway, Vascular smooth muscle contraction, VEGF signaling pathway |
Full Length : | Full L. |
Gene Name | MAP2K1 mitogen-activated protein kinase kinase 1 [ Homo sapiens (human) ] |
Official Symbol | MAP2K1 |
Synonyms | MEL; CFC3; MEK1; MKK1; MAPKK1; PRKMK1 |
Gene ID | 5604 |
mRNA Refseq | NM_002755.4 |
Protein Refseq | NP_002746.1 |
MIM | 176872 |
UniProt ID | Q02750 |
◆ Recombinant Proteins | ||
Map2k1-1350MAF647 | Recombinant Mouse Map2k1 Protein, His/GST-tagged, Alexa Fluor 647 conjugated | +Inquiry |
MAP2K1-483MAF555 | Recombinant Mouse Map2k1 Protein, Gly/Pro-tagged, Alexa Fluor 555 conjugated | +Inquiry |
MAP2K1-3430H | Recombinant Human MAP2K1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP2K1-343H | Recombinant Human MAP2K1 | +Inquiry |
Map2k1-1032M | Active Recombinant Mouse Map2k1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP2K1-001MCL | Recombinant Mouse MAP2K1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAP2K1 Products
Required fields are marked with *
My Review for All MAP2K1 Products
Required fields are marked with *
0
Inquiry Basket