Recombinant Full Length Human MAIP1 Protein, GST-tagged

• Cat.No.: MAIP1-4931HF
• Product Overview: Human FLJ22555 full-length ORF ( AAH17959, 1 a.a. - 291 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 291 amino acids
• Description: MAIP1 (Matrix AAA Peptidase Interacting Protein 1) is a Protein Coding gene.
• Molecular Mass: 57.75 kDa
• AA Sequence: MALAARLQPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARALAASALPAQGSRWPVLSSPGLPAAFTSFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKSALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETLRGASVFQVKLGNQNVETNQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MAIP1 matrix AAA peptidase interacting protein 1 [ Homo sapiens (human) ]
• Official Symbol: MAIP1
• Synonyms: C2ORF47; chromosome 2 open reading frame 47; uncharacterized protein C2orf47, mitochondrial; DKFZp666A212; FLJ22555; MAIP1; matrix AAA peptidase interacting protein 1
• Gene ID: 79568
• mRNA Refseq: NM_024520
• Protein Refseq: NP_078796
• MIM: 617267
• UniProt ID: Q8WWC4