Recombinant Full Length Human Magnesium Transporter Protein 1(Magt1) Protein, His-Tagged
Cat.No. : | RFL12122HF |
Product Overview : | Recombinant Full Length Human Magnesium transporter protein 1(MAGT1) Protein (Q9H0U3) (30-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (30-335) |
Form : | Lyophilized powder |
AA Sequence : | QRKKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTALQLHRQCVV CKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPK RGDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSN MEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAET HIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGYP YSFLMS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MAGT1 |
Synonyms | MAGT1; IAG2; PSEC0084; UNQ628/PRO1244; Magnesium transporter protein 1; MagT1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; Oligosaccharyl transferase subunit MAGT1; Implantation-associated protein; IAP |
UniProt ID | Q9H0U3 |
◆ Native Proteins | ||
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
PLG-30880TH | Native Human PLG | +Inquiry |
ALPP-8005H | Native Human Placental Alkaline Phosphatase | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
Proteoglycans-53H | Native Human Proteoglycans | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP14-4279HCL | Recombinant Human MMP14 293 Cell Lysate | +Inquiry |
HepG2-163H | HepG2 Whole Cell Lysate | +Inquiry |
ZNF264-107HCL | Recombinant Human ZNF264 293 Cell Lysate | +Inquiry |
EEPD1-920HCL | Recombinant Human EEPD1 cell lysate | +Inquiry |
Lung-329C | Cynomolgus monkey Lung: Trachea Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAGT1 Products
Required fields are marked with *
My Review for All MAGT1 Products
Required fields are marked with *
0
Inquiry Basket