Recombinant Full Length Human MAFG Protein, C-Flag-tagged

• Cat.No.: MAFG-1149HFL
• Product Overview: Recombinant Full Length Human MAFG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Globin gene expression is regulated through nuclear factor erythroid-2 (NFE2) elements located in enhancer-like locus control regions positioned many kb upstream of alpha- and beta-gene clusters. NFE2 DNA-binding activity consists of a heterodimer containing a ubiquitous small Maf protein and the tissue-restricted protein p45 NFE2. Both subunits are members of the activator protein-1-like superfamily of basic leucine zipper (bZIP) proteins.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 17.7 kDa
• AA Sequence: MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRV KRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFARTVARSPVAPARGPLAAGLGPL
  VPGKVAATSVITIVKSKTDARSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Transcription Factors
• Full Length: Full L.

Gene Information

• Gene Name: MAFG MAF bZIP transcription factor G [ Homo sapiens (human) ]
• Official Symbol: MAFG
• Synonyms: hMAF
• Gene ID: 4097
• mRNA Refseq: NM_002359.4
• Protein Refseq: NP_002350.1
• MIM: 602020
• UniProt ID: O15525