Recombinant Full Length Human LYG2 Protein, GST-tagged

Cat.No. : LYG2-6234HF
Product Overview : Human LYG2 full-length ORF ( NP_783862.2, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 212 amino acids
Description : The protein encoded by this gene contains a SLT domain, a protein domain present in bacterial lytic transglycosylase (SLT) and in eukaryotic lysozymes (GEWL). SLT domain catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyglucosamine (GlcNAc). [provided by RefSeq
Molecular Mass : 49.9 kDa
AA Sequence : MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LYG2 lysozyme G-like 2 [ Homo sapiens ]
Official Symbol LYG2
Synonyms LYG2; lysozyme G-like 2; lysozyme g-like protein 2; LYGH; MGC119046; MGC119047; MGC119049;
Gene ID 254773
mRNA Refseq NM_175735
Protein Refseq NP_783862
MIM 616547
UniProt ID Q86SG7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LYG2 Products

Required fields are marked with *

My Review for All LYG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon